PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_37267_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 97aa    MW: 11317.3 Da    PI: 10.5322
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_37267_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.83.3e-291059251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    +i+n + rqvtfskRr g++KKAeELSvLCda+va+iifs tgkl+eyss
  Neem_37267_f_1 10 KIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSATGKLFEYSS 59
                    69**********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.1E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.095161IPR002100Transcription factor, MADS-box
CDDcd002655.79E-34257No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-27323IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-28364IPR002100Transcription factor, MADS-box
PfamPF003192.0E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-273859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 97 aa     Download sequence    Send to blast
MAREKIQIRK IDNATARQVT FSKRRRGLFK KAEELSVLCD ADVALIIFSA TGKLFEYSSS  60
RSFSIFFLLE FQKESLRLMR NYLDHLLLDQ LVSALIR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D2e-18260159Myocyte-specific enhancer factor 2A
3mu6_C2e-18260159Myocyte-specific enhancer factor 2A
3mu6_B2e-18260159Myocyte-specific enhancer factor 2A
3mu6_A2e-18260159Myocyte-specific enhancer factor 2A
1egw_D2e-18260159MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-18260159MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-18260159MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A2e-18260159MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016486878.15e-35PREDICTED: MADS-box protein JOINTLESS-like
SwissprotQ9FVC17e-35SVP_ARATH; MADS-box protein SVP
TrEMBLE9JTW15e-35E9JTW1_COFAR; MADS-box protein STMADS11 subfamily
STRINGGLYMA01G02880.12e-33(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.23e-32MIKC_MADS family protein